PDB entry 1how

View 1how on RCSB PDB site
Description: the x-ray crystal structure of sky1p, an sr protein kinase in yeast
Class: transferase
Keywords: kinase
Deposited on 2000-12-11, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase ymr216c
    Species: Saccharomyces cerevisiae
    Gene: YMR216C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03656
      • conflict (6)
      • insertion (166)
      • insertion (166)
    Domains in SCOP 1.75: d1howa_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1howA (A:)
    dyrpggfhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyte
    aaedeikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllali
    kkyehrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikia
    dlgnacwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeg
    hsytkdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvlteky
    kfskdeakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdi
    pgwfeevrdhkrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1howA (A:)
    fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
    kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
    gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
    wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepddddhiaqi
    iellgelpsyllrngkytrtffsklkfwpledvltekykfskdeakeisdflspmlqldp
    rkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr