PDB entry 1how

View 1how on RCSB PDB site
Description: the x-ray crystal structure of sky1p, an sr protein kinase in yeast
Deposited on 2000-12-11, released 2001-02-28
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1howa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1howA (A:)
    fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
    kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
    gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
    wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkd
    ddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskde
    akeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfee
    vr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1howA (A:)
    fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
    kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
    gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
    wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepddddhiaqi
    iellgelpsyllrngkytrtffsklkfwpledvltekykfskdeakeisdflspmlqldp
    rkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr