PDB entry 1hon

View 1hon on RCSB PDB site
Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from escherichia coli at ph 6.5 and 25 degree celsius
Deposited on 1996-04-26, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hona_
  • Chain 'B':
    Domains in SCOP 1.55: d1honb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1honA (A:)
    gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
    renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
    rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
    vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
    snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
    tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
    aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
    etmilrdpfda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1honB (B:)
    gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
    renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
    rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
    vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
    snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
    tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
    aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
    etmilrdpfda