PDB entry 1hom

View 1hom on RCSB PDB site
Description: determination of the three-dimensional structure of the antennapedia homeodomain from drosophila in solution by 1h nuclear magnetic resonance spectroscopy
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antennapedia protein
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02833 (1-67)
  Domains in SCOPe 2.06: d1homa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1homA (A:)
  mrkrgrqtytryqtlelekefhfnryltrrrrieiahalclterqikiwfqnrrmkwkke
  nktkgepg