PDB entry 1hoc

View 1hoc on RCSB PDB site
Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
Class: histocompatibility antigen
Keywords: histocompatibility antigen
Deposited on 1994-01-02, released 1994-04-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I histocompatibility antigen (h2-db) (alpha chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hoca1, d1hoca2
  • Chain 'B':
    Compound: beta 2-microglobulin
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hocb_
  • Chain 'C':
    Compound: 9-residue peptide
    Species: Influenza A virus
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hocA (A:)
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwasvvvplgkeqnytcrvyheglpepltl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hocB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'C':
    No sequence available.