PDB entry 1hoc

View 1hoc on RCSB PDB site
Description:
Deposited on 1994-01-02, released 1994-04-30
The last revision prior to the SCOP 1.69 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1hoca1, d1hoca2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1hocb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hocA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hocB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm