PDB entry 1ho0

View 1ho0 on RCSB PDB site
Description: new b-chain mutant of bovine insulin
Class: hormone/growth factor
Keywords: beta_turn (20-23), alpha_helix (9-19), hormone/growth factor complex
Deposited on 2000-12-08, released 2000-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01317 (0-29)
      • engineered (6)
      • engineered (18)
    Domains in SCOPe 2.07: d1ho0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ho0A (A:)
    fvnqhlsgshlvealylvsgergffytpka