PDB entry 1ho0

View 1ho0 on RCSB PDB site
Description: new b-chain mutant of bovine insulin
Deposited on 2000-12-08, released 2000-12-20
The last revision was dated 2021-10-27, with a file datestamp of 2021-10-22.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01317 (0-29)
      • engineered mutation (6)
      • engineered mutation (18)

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ho0A (A:)
fvnqhlsgshlvealylvsgergffytpka