PDB entry 1hnz

View 1hnz on RCSB PDB site
Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Deposited on 2000-12-08, released 2001-02-21
The last revision prior to the SCOP 1.71 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.218
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.71: d1hnzb_
  • Chain 'C':
    Domains in SCOP 1.71: d1hnzc1, d1hnzc2
  • Chain 'D':
    Domains in SCOP 1.71: d1hnzd_
  • Chain 'E':
    Domains in SCOP 1.71: d1hnze1, d1hnze2
  • Chain 'F':
    Domains in SCOP 1.71: d1hnzf_
  • Chain 'G':
    Domains in SCOP 1.71: d1hnzg_
  • Chain 'H':
    Domains in SCOP 1.71: d1hnzh_
  • Chain 'I':
    Domains in SCOP 1.71: d1hnzi_
  • Chain 'J':
    Domains in SCOP 1.71: d1hnzj_
  • Chain 'K':
    Domains in SCOP 1.71: d1hnzk_
  • Chain 'L':
    Domains in SCOP 1.71: d1hnzl_
  • Chain 'M':
    Domains in SCOP 1.71: d1hnzm_
  • Chain 'N':
    Domains in SCOP 1.71: d1hnzn_
  • Chain 'O':
    Domains in SCOP 1.71: d1hnzo_
  • Chain 'P':
    Domains in SCOP 1.71: d1hnzp_
  • Chain 'Q':
    Domains in SCOP 1.71: d1hnzq_
  • Chain 'R':
    Domains in SCOP 1.71: d1hnzr_
  • Chain 'S':
    Domains in SCOP 1.71: d1hnzs_
  • Chain 'T':
    Domains in SCOP 1.71: d1hnzt_
  • Chain 'V':
    Domains in SCOP 1.71: d1hnzv_

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hnzB (B:)
    mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
    lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
    lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
    fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    eaeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzB (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hnzC (C:)
    mgnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdiera
    adnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrv
    aeqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlra
    nidygfalarttygvlgvkayiflgeviggqkpkarpelpkaeerprrrrpavrvkkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzC (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hnzD (D:)
    mgryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlre
    kqklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarql
    vrhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldveg
    mkgkflrlpdredlalpvneqlviefysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzD (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hnzE (E:)
    mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
    yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
    kelgsrnpiniayatmealrqlrtkadverlrkgeahaqaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzE (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnzF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1hnzG (G:)
    marrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplk
    vfkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavri
    ahelmdaaegkggavkkkedvermaeanrayahyrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzG (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnzH (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1hnzI (I:)
    meqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfd
    ayitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkar
    rapqyskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzI (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1hnzJ (J:)
    mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
    ehfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzJ (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1hnzK (K:)
    makkpskkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpya
    aqlaaldaakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcr
    pkkkfrkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzK (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1hnzL (L:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1hnzM (M:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzM (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1hnzN (N:)
    markaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkas
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzN (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1hnzO (O:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgirg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzO (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnzP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1hnzQ (Q:)
    mpkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveii
    esrpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzQ (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1hnzR (R:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzR (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1hnzS (S:)
    mprslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpv
    yitenmvghklgefaptrtyrghgkeakatkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1hnzT (T:)
    maqkkpkrnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkae
    slidkaakgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzT (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1hnzV (V:)
    gkgdrrtrrgkiwrgtygkyrprkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnzV (V:)
    gkgdrrtrrgkiwrgtygkyrprk