PDB entry 1hnr

View 1hnr on RCSB PDB site
Description: h-ns (dna-binding domain)
Deposited on 1995-04-06, released 1995-07-10
The last revision prior to the SCOP 1.67 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1hnr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnr_ (-)
    aqrpakysyvdengetktwtgqgrtpavikkamdeqgkslddflikq