PDB entry 1hno

View 1hno on RCSB PDB site
Description: crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae
Deposited on 2000-12-08, released 2001-06-20
The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-05, with a file datestamp of 2001-09-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1hnoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hnoA (A:)
    nekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrffs
    sgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpaigls
    aalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkyd
    imcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnka
    nsvevneslkywvdgeplkrfrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnoA (A:)
    nekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrffs
    sgadfketskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalvalcdivysind
    kvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmp
    ssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevneslkywvdg
    eplkrfrq