PDB entry 1hnn

View 1hnn on RCSB PDB site
Description: crystal structure of human pnmt complexed with sk&f 29661 and adohcy(sah)
Class: transferase
Keywords: methyltransferase, adrenaline synthesis, S-adenosyl methionine
Deposited on 2000-12-07, released 2001-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylethanolamine N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hnna_
  • Chain 'B':
    Compound: Phenylethanolamine N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hnnb_
  • Heterogens: SAH, SKF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hnnA (A:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnnA (A:)
    avasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsg
    ptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwq
    dkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhi
    ttllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpah
    lqtgvddvkgvffawaqkvgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hnnB (B:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnnB (B:)
    pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
    tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
    egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
    fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
    rtyimpahlqtgvddvkgvffawaqkv