PDB entry 1hnk

View 1hnk on RCSB PDB site
Description: crystal structure of beta-ketoacyl-acp synthase III, apo tetragonal form
Class: transferase
Keywords: fabh, TRANSFERASE
Deposited on 2000-12-07, released 2000-12-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl-acyl carrier protein synthase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hnka1, d1hnka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hnkA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnkA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsafpsaacqiqsmlgikgcpafdvaaacagftyalsvad
    qyvksgavkyalvvgsdvlarttiiifgdgagaavlaaseepgiisthlhadgstelahi
    vdetlaannldrsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpca
    ldeavrdgrikpgqlvlleafftwgsalvrf