PDB entry 1hnh

View 1hnh on RCSB PDB site
Description: crystal structure of beta-ketoacyl-acp synthase III + degraded form of acetyl-coa
Class: transferase
Keywords: FabH, TRANSFERASE
Deposited on 2000-12-07, released 2000-12-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl-acyl carrier protein synthase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6R0 (0-316)
      • modified residue (0)
      • modified residue (24)
      • modified residue (53)
      • modified residue (64)
      • modified residue (96)
      • modified residue (111)
      • modified residue (206)
      • modified residue (259)
      • modified residue (261)
    Domains in SCOPe 2.06: d1hnha1, d1hnha2
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnhA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf