PDB entry 1hnh

View 1hnh on RCSB PDB site
Description: crystal structure of beta-ketoacyl-acp synthase iii + degraded form of acetyl-coa
Deposited on 2000-12-07, released 2000-12-27
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnhA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf