PDB entry 1hng

View 1hng on RCSB PDB site
Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2
Class: t lymphocyte adhesion glycoprotein
Keywords: t lymphocyte adhesion glycoprotein
Deposited on 1994-08-10, released 1995-02-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08921 (Start-175)
      • conflict (89)
    Domains in SCOPe 2.01: d1hnga1, d1hnga2
  • Chain 'B':
    Compound: cd2
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08921 (Start-175)
      • conflict (89)
    Domains in SCOPe 2.01: d1hngb1, d1hngb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hngA (A:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilan
    gdlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevl
    egtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hngA (A:)
    dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang
    dlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevle
    gtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hngB (B:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilan
    gdlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevl
    egtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hngB (B:)
    dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang
    dlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevle
    gtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe