PDB entry 1hnf

View 1hnf on RCSB PDB site
Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution
Class: t lymphocyte adhesion glycoprotein
Keywords: t lymphocyte adhesion glycoprotein
Deposited on 1994-08-10, released 1995-02-07
The last revision prior to the SCOP 1.75 freeze date was dated 1995-02-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hnfa1, d1hnfa2
  • Heterogens: NAG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hnfA (A:)
    keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
    klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqervskpkiswtcinttl
    tcevmngtdpelnlyqdgkhlklsqrvithkwttslsakfkctagnkvskessvepvscp
    ek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hnfA (A:)
    tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyklf
    kngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqervskpkiswtcinttltce
    vmngtdpelnlyqdgkhlklsqrvithkwttslsakfkctagnkvskessvepvscpek