PDB entry 1hnf

View 1hnf on RCSB PDB site
Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution
Deposited on 1994-08-10, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hnf_ (-)
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyklf
kngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqervskpkiswtcinttltce
vmngtdpelnlyqdgkhlklsqrvithkwttslsakfkctagnkvskessvepvscpek