PDB entry 1hne

View 1hne on RCSB PDB site
Description: Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-angstroms resolution
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 1989-04-10, released 1989-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.164
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: human leucocyte elastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08246 (0-217)
      • conflict (77)
    Domains in SCOPe 2.06: d1hnee_
  • Chain 'I':
    Compound: methoxysuccinyl-ala-ala-pro-ala chloromethyl ketone inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1HNE (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hneE (E:)
    ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl
    srreptrqvfavqrifedgydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv
    qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn
    glihgiasfvrggcasglypdafapvaqfvnwidsiiq
    

  • Chain 'I':
    No sequence available.