PDB entry 1hnd

View 1hnd on RCSB PDB site
Description: crystal structure of beta-ketoacyl-acp synthase III-coa complex
Class: transferase
Keywords: FabH
Deposited on 2000-12-07, released 2000-12-27
The last revision prior to the SCOP 1.73 freeze date was dated 2001-03-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.213
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl-acyl carrier protein synthase III
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hnda1, d1hnda2
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hndA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf