PDB entry 1hna

View 1hna on RCSB PDB site
Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Class: transferase(glutathione)
Keywords: transferase(glutathione)
Deposited on 1993-10-15, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.226
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28161 (0-216)
      • conflict (213)
    Domains in SCOPe 2.04: d1hnaa1, d1hnaa2
  • Heterogens: GDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnaA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavfgnk