PDB entry 1hn7

View 1hn7 on RCSB PDB site
Description: nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetilcholine receptor
Deposited on 2000-12-07, released 2000-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1hn7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hn7A (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg