PDB entry 1hn6

View 1hn6 on RCSB PDB site
Description: solution structure of plasmodium falciparum apical membrane antigen 1 (residues 436-545)
Class: membrane protein
Keywords: disulphide connectivities, MEMBRANE PROTEIN
Deposited on 2000-12-07, released 2002-10-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apical membrane antigen 1
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF83
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1hn6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hn6A (A:)
    evennfpcslykdeimkeiereskriklndnddegnkkiiaprifisddkdslkcpcdpe
    mvsnstcrffvckcverraevtsnnevvvkeeykdeyadipehkptydkm