PDB entry 1hn4

View 1hn4 on RCSB PDB site
Description: prophospholipase a2 dimer complexed with mj33, sulfate, and calcium
Class: hydrolase
Keywords: Hydrolase, Enzyme, Carboxylic Ester Hydrolase, Dimer, Sulfate Binding, Inhibitor Binding
Deposited on 2000-12-06, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.215
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prophospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hn4a_
  • Chain 'B':
    Compound: prophospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hn4b_
  • Heterogens: CA, SO4, MJI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hn4A (A:)
    qegissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyr
    daknldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynk
    ehknldtkkyc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hn4A (A:)
    gissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrda
    knldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkeh
    knldtkkyc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hn4B (B:)
    qegissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyr
    daknldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynk
    ehknldtkkyc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hn4B (B:)
    qegissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyr
    daknldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynk
    ehknldc