PDB entry 1hn3

View 1hn3 on RCSB PDB site
Description: solution structure of the n-terminal 37 amino acids of the mouse arf tumor suppressor protein
Class: antitumor protein
Keywords: Arf, p19Arf, Tumor Suppressor, p53, mdm2, ANTITUMOR PROTEIN
Deposited on 2000-12-05, released 2001-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p19 arf protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64364 (3-39)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1hn3a1, d1hn3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hn3A (A:)
    gshmgrrflvtvriqragrplqervflvkfvrsrrprtas