PDB entry 1hn1

View 1hn1 on RCSB PDB site
Description: e. coli (lac z) beta-galactosidase (orthorhombic)
Deposited on 2000-12-05, released 2001-12-12
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hn1A (A:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hn1B (B:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hn1C (C:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hn1D (D:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk