PDB entry 1hmx

View 1hmx on RCSB PDB site
Description: three-dimensional structure of the human immunodeficiency virus type 1 matrix protein
Deposited on 1995-03-17, released 1995-07-10
The last revision was dated 1995-07-10, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1hmx_ (-)
hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
adtgnnsqvsqny

  • Chain 'p':
    No sequence available.