PDB entry 1hmw

View 1hmw on RCSB PDB site
Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
Class: lyase
Keywords: protein-oligosaccharide complex, active site, catalysis, LYASE
Deposited on 2000-12-05, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chondroitinase ac
    Species: Pedobacter heparinus [TaxId:984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hmwa1, d1hmwa2, d1hmwa3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hmwA (A:)
    mkklfvtcivffsilspalliaqqtgtaelimkrvmldlkkplrnmdkvaeknlntlqpd
    gswkdvpykddamtnwlpnnhllqletiiqayiekdshyygddkvfdqiskafkywydsd
    pksrnwwhneiatpqalgemlilmrygkkpldealvhkltermkrgepekktganktdia
    lhyfyralltsdeallsfavkelfypvqfvhyeeglqydysylqhgpqlqissygavfit
    gvlklanyvrdtpyalsteklaifskyyrdsylkairgsymdfnvegrgvsrpdilnkka
    ekkrllvakmidlkhteewadaiartdstvaagykiepyhhqfwngdyvqhlrpaysfnv
    rmvskrtrrsesgnkenllgrylsdgatniqlrgpeyynimpvwewdkipgitsrdyltd
    rpltklwgeqgsndfaggvsdgvygasayaldydslqakkawfffdkeivclgaginsna
    penitttlnqswlngpvistagktgrgkittfkaqgqfwllhdaigyyfpeganlslstq
    sqkgnwfhinnshskdevsgdvfklwinhgarpenaqyayivlpginkpeeikkyngtap
    kvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaad
    plqkektavlsirdlktgktnrvkidfpqqefagatvelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hmwA (A:)
    gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
    etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
    ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
    pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
    kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
    tdstvaagykiepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsd
    gatniqlrgpeyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvyg
    asayaldydslqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktg
    rgkittfkaqgqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfkl
    winhgarpenaqyayivlpginkpeeikkyngtapkvlantnqlqavyhqqldmvqaify
    tagklsvagieietdkpcavlikhingkqviwaadplqkektavlsirdlktgktnrvki
    dfpqqefagatvel