PDB entry 1hmq

View 1hmq on RCSB PDB site
Description: adjustment of restraints in the refinement of methemerythrin and azidomethemerythrin at 2.0 angstroms resolution
Deposited on 1983-02-24, released 1983-05-02
The last revision was dated 1992-01-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'D':
    no info in PDB for this chain
  • Heterogens: FEO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1hmqA (A:)
    gfpipdpycwdisfrtfytivddehktlfngilllsqadnadhlnelrrctgkhflneqq
    lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1hmqB (B:)
    gfpipdpycwdisfrtfytivddehktlfngilllsqadnadhlnelrrctgkhflneqq
    lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1hmqC (C:)
    gfpipdpycwdisfrtfytivddehktlfngilllsqadnadhlnelrrctgkhflneqq
    lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1hmqD (D:)
    gfpipdpycwdisfrtfytivddehktlfngilllsqadnadhlnelrrctgkhflneqq
    lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki