PDB entry 1hmj

View 1hmj on RCSB PDB site
Description: solution structure of RNA polymerase subunit h
Class: RNA polymerase
Keywords: RNA polymerase, subunit h, rpb5, archaea
Deposited on 1999-02-05, released 1999-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (subunit h)
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hmja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1hmjA (A:)
mkvtdhilvpkheivpkeeveeilkrynikiqqlpkiyeddpviqeigakegdvvrvirk
sptagvsiayrlvikrii

    Sequence, based on observed residues (ATOM records): (download) 
    >1hmjA (A:)
pkheivpkeeveeilkrynikiqqlpkiyeddpviqeigakegdvvrvirksptagvsia
yrlvikri