PDB entry 1hmf

View 1hmf on RCSB PDB site
Description: structure of the hmg box motif in the b-domain of hmg1
Deposited on 1994-03-07, released 1994-05-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1hmf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hmf_ (-)
    fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
    aklkekyekdiaayrak