PDB entry 1hme

View 1hme on RCSB PDB site
Description: structure of the hmg box motif in the b-domain of hmg1
Deposited on 1994-02-10, released 1994-05-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1hme__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hme_ (-)
  fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
  aklkekyekdiaayrak