PDB entry 1hmd

View 1hmd on RCSB PDB site
Description: the structure of deoxy and oxy hemerythrin at 2.0 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1990-10-18, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemerythrin
  Species: Themiste dyscritum [TaxId:6436]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02246 (0-112)
    • conflict (20)
    • conflict (63)
  Domains in SCOPe 2.08: d1hmda_
• Chain 'B':
  Compound: hemerythrin
  Species: Themiste dyscritum [TaxId:6436]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02246 (0-112)
    • conflict (20)
    • conflict (63)
  Domains in SCOPe 2.08: d1hmdb_
• Chain 'C':
  Compound: hemerythrin
  Species: Themiste dyscritum [TaxId:6436]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02246 (0-112)
    • conflict (20)
    • conflict (63)
  Domains in SCOPe 2.08: d1hmdc_
• Chain 'D':
  Compound: hemerythrin
  Species: Themiste dyscritum [TaxId:6436]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02246 (0-112)
    • conflict (20)
    • conflict (63)
  Domains in SCOPe 2.08: d1hmdd_
• Heterogens: ACE, FEO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hmdA (A:)
  gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
  lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hmdB (B:)
  gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
  lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hmdC (C:)
  gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
  lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hmdD (D:)
  gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
  lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki