PDB entry 1hma

View 1hma on RCSB PDB site
Description: the solution structure and dynamics of the DNA binding domain of hmg-d from drosophila melanogaster
Class: DNA-binding
Keywords: DNA-binding
Deposited on 1994-05-12, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hmg-d
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hmaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hmaA (A:)
    sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang