PDB entry 1hm8

View 1hm8 on RCSB PDB site
Description: crystal structure of s.pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a
Deposited on 2000-12-05, released 2001-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-30, with a file datestamp of 2001-11-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hm8A (A:)
    mrgshhhhhhsnfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtv
    vghkaelveevlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgesl
    knlidfhinhknvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintg
    tyvfdnerlfealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrva
    lataesvmrrrinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetv
    ltngtyvvdstigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkg
    ssigentkaghltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiap
    velgdnslvgagstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hm8A (A:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
    ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
    rinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvds
    tigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkag
    hltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvg
    agstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hm8B (B:)
    mrgshhhhhhsnfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtv
    vghkaelveevlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgesl
    knlidfhinhknvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintg
    tyvfdnerlfealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrva
    lataesvmrrrinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetv
    ltngtyvvdstigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkg
    ssigentkaghltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiap
    velgdnslvgagstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hm8B (B:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
    ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
    rinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvds
    tigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkag
    hltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvg
    agstitkdvpadaiaigrgrqinkdeyatrlphhpknq