PDB entry 1hm2

View 1hm2 on RCSB PDB site
Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
Class: lyase
Keywords: protein-oligosaccharide complex, active site, catalysis
Deposited on 2000-12-04, released 2001-05-02
The last revision prior to the SCOP 1.75 freeze date was dated 2001-05-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chondroitinase ac
    Species: Pedobacter heparinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hm2a1, d1hm2a2, d1hm2a3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hm2A (A:)
    mkklfvtcivffsilspalliaqqtgtaelimkrvmldlkkplrnmdkvaeknlntlqpd
    gswkdvpykddamtnwlpnnhllqletiiqayiekdshyygddkvfdqiskafkywydsd
    pksrnwwhneiatpqalgemlilmrygkkpldealvhkltermkrgepekktganktdia
    lhyfyralltsdeallsfavkelfypvqfvhyeeglqydysylqhgpqlqissygavfit
    gvlklanyvrdtpyalsteklaifskyyrdsylkairgsymdfnvegrgvsrpdilnkka
    ekkrllvakmidlkhteewadaiartdstvaagykiepyhhqfwngdyvqhlrpaysfnv
    rmvskrtrrsesgnkenllgrylsdgatniqlrgpeyynimpvwewdkipgitsrdyltd
    rpltklwgeqgsndfaggvsdgvygasayaldydslqakkawfffdkeivclgaginsna
    penitttlnqswlngpvistagktgrgkittfkaqgqfwllhdaigyyfpeganlslstq
    sqkgnwfhinnshskdevsgdvfklwinhgarpenaqyayivlpginkpeeikkyngtap
    kvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaad
    plqkektavlsirdlktgktnrvkidfpqqefagatvelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hm2A (A:)
    gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
    etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
    ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
    pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
    kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
    tdstvaagykiepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsd
    gatniqlrgpeyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvyg
    asayaldydslqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktg
    rgkittfkaqgqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfkl
    winhgarpenaqyayivlpginkpeeikkyngtapkvlantnqlqavyhqqldmvqaify
    tagklsvagieietdkpcavlikhingkqviwaadplqkektavlsirdlktgktnrvki
    dfpqqefagatvel