PDB entry 1hm0

View 1hm0 on RCSB PDB site
Description: crystal structure of s.pneumoniae n-acetylglucosamine 1-phosphate uridyltransferase, glmu
Class: transferase
Keywords: Rossmann-like fold, left-handed-beta-helix, trimer, domain-interchange
Deposited on 2000-12-04, released 2001-11-30
The last revision prior to the SCOP 1.73 freeze date was dated 2001-11-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylglucosamine 1-phosphate uridyltransferase
    Species: Streptococcus pneumoniae
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hm0a1, d1hm0a2
  • Chain 'B':
    Compound: n-acetylglucosamine 1-phosphate uridyltransferase
    Species: Streptococcus pneumoniae
    Gene: glmU
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hm0b1, d1hm0b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hm0A (A:)
    mrgshhhhhhsnfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtv
    vghkaelveevlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgesl
    knlidfhinhknvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintg
    tyvfdnerlfealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrva
    lataesvmrrrinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetv
    ltngtyvvdstigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkg
    ssigentkaghltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiap
    velgdnslvgagstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hm0A (A:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivvlriveqkdatdfekqikeintgtyvfdnerlfealkni
    ntnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrrrinhkh
    mvngvsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigaga
    vitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyig
    ncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstit
    kdvpadaiaigrgrqinkde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hm0B (B:)
    mrgshhhhhhsnfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtv
    vghkaelveevlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgesl
    knlidfhinhknvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintg
    tyvfdnerlfealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrva
    lataesvmrrrinhkhmvngvsfvnpeatyididveiapevqieanvilkgqtkigaetv
    ltngtyvvdstigagavitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkg
    ssigentkaghltyigncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiap
    velgdnslvgagstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hm0B (B:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivvlriveqkdatdfekqikeintgtyvfdnerlfealkni
    ntnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrrrinhkh
    mvngvsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigaga
    vitnsmieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyig
    ncevgsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstit
    kdvpadaiaigrgrqinkde