PDB entry 1hly

View 1hly on RCSB PDB site
Description: solution structure of hongotoxin 1
Class: toxin
Keywords: scorpion, toxin, centruroides limbatus Hgtx1, potassium channel
Deposited on 2000-12-04, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hongotoxin 1
    Species: Centruroides limbatus [TaxId:244936]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hlya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlyA (A:)
    tvidvkctspkqclppckaqfgiragakcmngkckcyph