PDB entry 1hlv

View 1hlv on RCSB PDB site
Description: crystal structure of cenp-b(1-129) complexed with the cenp-b box DNA
Class: DNA binding protein/DNA
Keywords: HELIX-TURN-HELIX, PROTEIN-DNA COMPLEX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2000-12-04, released 2002-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major centromere autoantigen b
    Species: Homo sapiens [TaxId:9606]
    Gene: CENP-B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07199 (0-128)
      • cloning artifact (129-130)
    Domains in SCOPe 2.06: d1hlva1, d1hlva2, d1hlva3
  • Chain 'B':
    Compound: cenp-b box DNA
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: cenp-b box DNA
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlvA (A:)
    mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailaserkyg
    vastcrktnklspydkleglliawfqqiraaglpvkgiilkekalriaeelgmddftasn
    gwldrfrrrrs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.