PDB entry 1hlu

View 1hlu on RCSB PDB site
Description: structure of bovine beta-actin-profilin complex with actin bound ATP phosphates solvent accessible
Class: complex (acetylation/actin-binding)
Keywords: COMPLEX (ACETYLATION-ACTIN-BINDING), ACTIN, PROFILIN, CONFORMATIONAL CHANGES, CYTOSKELETON, COMPLEX (ACETYLATION-ACTIN-BINDING) complex
Deposited on 1997-05-30, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-actin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60712 (0-373)
      • modified residue (71)
    Domains in SCOPe 2.07: d1hlua1, d1hlua2
  • Chain 'P':
    Compound: Profilin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hlup_
  • Heterogens: CA, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hluA (A:)
    dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
    rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
    imfetfntpamyvaiqavlslyasgrttgivmdsgdgvthtvpiyegyalphailrldla
    grdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksye
    lpdgqvitignerfrcpealfqpsflgmescgihettfnsimkcdvdirkdlyantvlsg
    gttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqe
    ydesgpsivhrkcf
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hluP (P:)
    agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
    ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
    gminkkcyemashlrrsqy