PDB entry 1hlp

View 1hlp on RCSB PDB site
Description: structural features stabilizing halophilic malate dehydrogenase from an archaebacterium
Deposited on 1994-10-04, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.182
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlpA (A:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlpB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis