PDB entry 1hlo
View 1hlo on RCSB PDB site
Description: the crystal structure of an intact human max-DNA complex: new insights into mechanisms of transcriptional control
Class: transcription/DNA
Keywords: transcriptional regulation, DNA binding, complex (transcription factor max/DNA), transcription/DNA complex
Deposited on
1997-09-10, released
1997-10-27
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (transcription factor max)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1hloa_ - Chain 'B':
Compound: protein (transcription factor max)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1hlob_ - Chain 'C':
Compound: DNA (5'-d(*cp*ap*cp*cp*ap*cp*gp*tp*gp*gp*t)-3')
- Chain 'D':
Compound: DNA (5'-d(*ap*cp*cp*ap*cp*gp*tp*gp*gp*tp*g)-3')
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1hloA (A:)
nddievesdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiq
ymrrknhthqqdiddlkrqn
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1hloB (B:)
nddievesdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiq
ymrrknhthqqdiddlkrqn
Sequence, based on observed residues (ATOM records): (download)
>1hloB (B:)
sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
thqqdiddlkrqn
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.