PDB entry 1hlo

View 1hlo on RCSB PDB site
Description: the crystal structure of an intact human max-dna complex: new insights into mechanisms of transcriptional control
Deposited on 1997-09-10, released 1997-10-27
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1hloa_
  • Chain 'B':
    Domains in SCOP 1.57: d1hlob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hloA (A:)
    nddievesdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiq
    ymrrknhthqqdiddlkrqn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hloB (B:)
    sdadkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknh
    thqqdiddlkrqn