PDB entry 1hlm

View 1hlm on RCSB PDB site
Description: amino acid sequence of a globin from the sea cucumber caudina (molpadia) arenicola
Deposited on 1994-08-26, released 1995-02-07
The last revision prior to the SCOP 1.65 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.19
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1hlm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlm_ (-)
    gatqsfqsvgdltpaekdlirstwdqlmthrtgfvadvfirifhndptaqrkfpqmagls
    paelrtsrqmhahairvsalmttyidemdtevlpellatltrthdknhvgkknydlfgkv
    lmeaikaelgvgftkqvhdawaktfaivqgvlitkhas