PDB entry 1hle

View 1hle on RCSB PDB site
Description: crystal structure of cleaved equine leucocyte elastase inhibitor determined at 1.95 angstroms resolution
Class: hydrolase inhibitor(serine proteinase)
Keywords: hydrolase inhibitor(serine proteinase)
Deposited on 1992-04-13, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: horse leukocyte elastase inhibitor
    Species: Equus caballus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05619 (0-343)
      • conflict (172)
      • conflict (252)
      • conflict (341)
    Domains in SCOP 1.73: d1hle.1
  • Chain 'B':
    Compound: horse leukocyte elastase inhibitor
    Species: Equus caballus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hle.1
  • Heterogens: CA, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hleA (A:)
meqlstanthfavdlfralnesdptgnifisplsissalamiflgtrgntaaqvskalyf
dtvedihsrfqslnadinkpgapyilklanrlygektynfladflastqkmygaelasvd
fqqapedarkeinewvkgqtegkipellvkgmvdnmtklvlvnaiyfkgnwqqkfmkeat
rdapfrlnkkdtktvkmmyqkkkfpynyiedlkcrvlelpyqgkelsmiillpddiedes
tglekiekqltldklrewtkpenlylaevnvhlprfkleesydltshlarlgvqdlfnrg
kadlsgmsgardlfvskiihksfvdlneegteaaaatagtilla

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hleB (B:)
eenfnadhpfiffirhnpsanilflgrfssp