PDB entry 1hle

View 1hle on RCSB PDB site
Description: crystal structure of cleaved equine leucocyte elastase inhibitor determined at 1.95 angstroms resolution
Deposited on 1992-04-13, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hle.1
  • Chain 'B':
    Domains in SCOP 1.55: d1hle.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hleA (A:)
    meqlstanthfavdlfralnesdptgnifisplsissalamiflgtrgntaaqvskalyf
    dtvedihsrfqslnadinkpgapyilklanrlygektynfladflastqkmygaelasvd
    fqqapedarkeinewvkgqtegkipellvkgmvdnmtklvlvnaiyfkgnwqqkfmkeat
    rdapfrlnkkdtktvkmmyqkkkfpynyiedlkcrvlelpyqgkelsmiillpddiedes
    tglekiekqltldklrewtkpenlylaevnvhlprfkleesydltshlarlgvqdlfnrg
    kadlsgmsgardlfvskiihksfvdlneegteaaaatagtilla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hleB (B:)
    eenfnadhpfiffirhnpsanilflgrfssp