PDB entry 1hlc

View 1hlc on RCSB PDB site
Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-II, in complex with lactose at 2.9 angstroms resolution
Class: lectin
Keywords: lectin
Deposited on 1993-10-13, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.177
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human lectin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hlca_
  • Chain 'B':
    Compound: human lectin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hlcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hlcA (A:)
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hlcB (B:)
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke