PDB entry 1hlb

View 1hlb on RCSB PDB site
Description: structural analysis of monomeric hemichrome and dimeric cyanomet hemoglobins from caudina arenicola
Deposited on 1994-03-22, released 1994-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.15
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1hlb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlb_ (-)
    ggtlaiqaqgdltlaqkkivrktwhqlmrnktsfvtdvfirifaydpsaqnkfpqmagms
    asqlrssrqmqahairvssimseyveeldsdilpellatlarthdlnkvgadhynlfakv
    lmealqaelgsdfnektrdawakafsvvqavllvkhg