PDB entry 1hl8

View 1hl8 on RCSB PDB site
Description: crystal structure of thermotoga maritima alpha-fucosidase
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, alpha-l-fucosidase, thermostable
Deposited on 2003-03-14, released 2004-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative alpha-l-fucosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hl8a1, d1hl8a2
  • Chain 'B':
    Compound: putative alpha-l-fucosidase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hl8b1, d1hl8b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hl8A (A:)
    mismkprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawff
    qnpyaewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagak
    yvipttkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrf
    ttepirypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfa
    yyynkhpegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpeh
    mlsveqlvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiygtsv
    werccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltgerlsfk
    nvgknleitvpkklletdsitlvleavee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl8A (A:)
    rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatpdawffqnpyaewyenslrik
    esptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvipttkhhdgfclw
    gtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepirypedlsyir
    pntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkhpegsvndrw
    gvphwdfktaeydlpgykweftrgiglsfgynrnegpehmlsveqlvytlvdvvskggnl
    llnvgpkgdgtipdlqkerllglgewlrkygdaiygtsvwerccaktedgteirftrkcn
    rifviflgiptgekiviedlnlsagtvrhfltgerlsfknvgknleitvpkklletdsit
    lvleav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hl8B (B:)
    mismkprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawff
    qnpyaewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagak
    yvipttkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrf
    ttepirypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfa
    yyynkhpegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpeh
    mlsveqlvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiygtsv
    werccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltgerlsfk
    nvgknleitvpkklletdsitlvleavee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl8B (B:)
    rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatdawffqnpyaewyenslrike
    sptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvipttkhhdgfclwg
    tkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepirypedlsyirp
    ntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkhpegsvndrwg
    vphwdfktaeyhlpgykweftrgiglsfgynrnehmlsveqlvytlvdvvskggnlllnv
    gpkgdgtipdlqkerllglgewlrkygdaiygtsvwerccaktedgteirftrkcnrifv
    iflgiptgekiviedlnlsagtvrhfltgerlsfknvgknleitvpkklletdsitlvle
    av