PDB entry 1hl7

View 1hl7 on RCSB PDB site
Description: Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one
Class: hydrolase
Keywords: hydrolase, alpha/beta hydrolase, co-factor free haloperoxidase, tetrahedral intermediate
Deposited on 2003-03-14, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma lactamase
    Species: MICROBACTERIUM SP. [TaxId:51671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hl7a_
  • Chain 'B':
    Compound: gamma lactamase
    Species: MICROBACTERIUM SP. [TaxId:51671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hl7b_
  • Heterogens: BD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hl7A (A:)
    gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg
    fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla
    flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq
    avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar
    rfhqavpeadyvevegaphgllwthadevnaalktflak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hl7B (B:)
    gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg
    fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla
    flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq
    avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar
    rfhqavpeadyvevegaphgllwthadevnaalktflak